PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00026505-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 339aa    MW: 37899.3 Da    PI: 6.2197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00026505-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.12.7e-201461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+lv++++q+G g+W++ ++  g++R++k+c++rw +yl
  WALNUT_00026505-RA 14 KGPWTPEEDEQLVQYIHQHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding53.45.9e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++++E++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  WALNUT_00026505-RA  67 RGKFSQDEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.898961IPR017930Myb domain
SuperFamilySSF466892.7E-3111108IPR009057Homeodomain-like
SMARTSM007171.8E-161363IPR001005SANT/Myb domain
PfamPF002491.3E-181461IPR001005SANT/Myb domain
CDDcd001672.01E-131661No hitNo description
PROSITE profilePS5129426.68862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2765117IPR009057Homeodomain-like
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002497.5E-1667112IPR001005SANT/Myb domain
CDDcd001674.68E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDEQLVQYIH QHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQDEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRT DLFSSLPHLL ALANLRDLME HHSLDEHALR IQAEAVQLVK IQCLQHLLQS  180
ATSMTTNSYG QNGITDMEAV NLFYSVPTIK ENPLLNSSQN ENPASFSLGN YVTPQPLHHP  240
SLLAHLSDPQ APFSFQTSFN SNEMGQGSDF AMISQGDNPP DDHSSLVFQF PSSVLSTMTD  300
ETSISNPGDA SSSTSSYGGG VSSYWSELYF EDPTMHEIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5000753e-46AB500075.1 Fagus crenata FcMYBFL11 mRNA for transcription factor MYBFL11, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307380.10.0hypothetical protein POPTR_0005s17080g
SwissprotQ8GWP06e-75MYB39_ARATH; Transcription factor MYB39
TrEMBLB9H7320.0B9H732_POPTR; Uncharacterized protein
STRINGPOPTR_0005s17080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-109myb domain protein 93